PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 137aa    MW: 14966 Da    PI: 8.4895
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58672772PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601491.2e-4681071100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+++l ++k+e
  Lsa017857   8 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQVDLTYAKSE 107
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2957108IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-458105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MASSSNSPCA ACKFLRRKCQ PECVFAPYFP PDQPQKFANV HKVFGASNVT KLLNELHPHQ  60
REDAVNSLAY EADMRLRDPV YGCVGVISLL QHQLRQLQVD LTYAKSELSK YQNHNHNLNG  120
SATQGLIAAA AAAAAAA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.13e-77PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.13e-77PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.13e-77PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.13e-77PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG31e-68LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLD7SSJ33e-77D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t018e-77(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-67LBD family protein